UGT1A10 (UDP-glucuronosyltransferase 1A10, UDP-glucuronosyltransferase 1-10, UDPGT 1-10, UGT1*10, UGT1-10, UGT1.10, UGT1, UDP-glucuronosyltransferase 1-J, UGT1J, UGT-1J, GNT1)

Size

£685.00

SKU:: 135068
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa187-290 from human UGT1A10 (NP_061948) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 0.1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: LSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.