Ubiquilin-2 (UBQLN2, Chap1, DSK2 Homolog, HRIHFB2157, N4BP4, Protein Linking IAP with Cytoskeleton 2, PLIC2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2)

Size

£685.00

SKU:: 135040
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa555-625 from human UBQLN2 (NP_038472) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5F5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.