134990-HRP

UBE2D1 (Ubiquitin-conjugating Enzyme E2 D1, Stimulator of Fe Transport, SFT, UBC4/5 Homolog, UbcH5, UBC5A, UBCH5, UBCH5A, Ubiquitin Carrier Protein D1, Ubiquitin-conjugating Enzyme E2(17)KB 1, Ubiquitin-conjugating Enzyme E2-17kD 1, Ubiquitin-protein Ligase D1) (HRP)

Size

£914.00

SKU:: 134990-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-94 from human UBE2D1 (NP_003329) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.