U2AF1RS2 (U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 35kD Subunit-related Protein 2, U2AF1-RS2, CCCH Type Zinc Finger, RNA-binding Motif and Serine/arginine Rich Protein 2, ZRSR2, Renal Carcinoma Antigen NY-REN-20, U2(RNU2) Small Nuclear RNA Auxiliary Factor 1-like 2, U2AF1L2, U2AF35-related Protein, URP)

Size

£685.00

SKU:: 134965
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa294-394 from U2AF1L2 (NP_005080) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.