134965-FITC

U2AF1RS2 (U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 35kD Subunit-related Protein 2, U2AF1-RS2, CCCH Type Zinc Finger, RNA-binding Motif and Serine/arginine Rich Protein 2, ZRSR2, Renal Carcinoma Antigen NY-REN-20, U2(RNU2) Small Nuclear RNA Auxiliary Factor 1-like 2, U2AF1L2, U2AF35-related Protein, URP) (FITC)

Size

£914.00

SKU:: 134965-FITC
Application:: FLISA
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa294-394 from U2AF1L2 (NP_005080) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.