134965-BIOTIN

U2AF1RS2 (U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 35kD Subunit-related Protein 2, U2AF1-RS2, CCCH Type Zinc Finger, RNA-binding Motif and Serine/arginine Rich Protein 2, ZRSR2, Renal Carcinoma Antigen NY-REN-20, U2(RNU2) Small Nuclear RNA Auxiliary Factor 1-like 2, U2AF1L2, U2AF35-related Protein, URP) (Biotin)

Size

£914.00

SKU:: 134965-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa294-394 from U2AF1L2 (NP_005080) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.