U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1, FP793, Splicing Factor U2AF 35kD Subunit, U2 Auxiliary Factor 35kD Subunit, U2AF35, U2 snRNP Auxiliary Factor Small Subunit, U2AFBP)

Size

£685.00

SKU:: 134964
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa56-155 from human U2AF1 (NP_006749) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.