134842-APC

TSSK6 (Testis-specific Serine/threonine-protein Kinase 6, TSSK-6, Testis-specific Kinase 6, TSK-6, Cancer/testis Antigen 72, CT72, FKSG82, Serine/threonine-protein Kinase SSTK, Small Serine/threonine Kinase, SSTK) (APC)

Size

£927.00

SKU:: 134842-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa174-274 from human TSSK6 (AAH14611) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6F5
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: FLISA: 30ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.