TSSK1B (Testis-specific Serine/threonine-protein Kinase 1, TSSK1, TSSK-1, Testis-specific Kinase 1, TSK1, TSK-1, FKSG81, Serine/threonine-protein Kinase 22A, STK22A, SPOGA1, SPOGA4, STK22D)

Size

£685.00

SKU:: 134833
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa267-367 from human TSSK1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E8
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LSHCWMQPKARGSPSVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETRAQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.