TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ)

Size

£685.00

SKU:: 134803
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-97 from human TSC22D3 (NP_932174) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The DSIPI protein has homology to porcine DIP (DSIP-immunoreactive peptide). The DSIPI protein contains a highly conserved leucine zipper region and belongs to the TSC-22/DIP/BUN family of transcriptional regulators. DSIPI is postulated to also function as a transcriptional regulator. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.