TRIM63 (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ)

Size

£685.00

SKU:: 134765
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa254-353 from human TRIM63 (NP_115977) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: E3 ubiquitin ligase. Regulates proteasomal degradation of cardiac troponin I/TNNI3 and probably of other sarcomeric-associated proteins. May play a role in striated muscle atrophy and hypertrophy by regulating an anti-hypertrophic PKC-mediated signaling pathway. May regulate the organization of myofibrils through TTN in muscle cells. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.