134753-BIOTIN

TRIM47 (Tripartite Motif-containing Protein 47, Gene Overexpressed in Astrocytoma Protein, RING Finger Protein 100, GOA, RNF100) (Biotin)

Size

£914.00

SKU:: 134753-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa539-639 from human TRIM47 (NP_258411) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: TRIM47 belongs to the TRIM/RBCC family. It contains one B box type zinc finger, one B30.2/SPRY domain and one RING type zinc finger. TRIM47 has low expression in most tissues; higher expression in kidney tubular cells and over expressed in astrocytoma tumor cells. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.