TRIM46 (Tripartite Motif-containing Protein 46, Gene Y Protein, FLJ23229, GeneY, Tripartite, Fibronectin Type-III and C-terminal SPRY Motif Protein, TRIFIC)

Size

£685.00

SKU:: 134751
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa451-561 from human TRIM46 (NP_079334) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Belongs to the TRIM/RBCC family. There are 4 isoforms of this protein. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.