134731-PE

TRIM24 (Transcription Intermediary Factor 1-alpha, TIF1-alpha, E3 Ubiquitin-protein Ligase TRIM24, RING Finger Protein 82, Tripartite Motif-containing Protein 24, RNF82, TIF1, TIF1A) (PE)

Size

£914.00

SKU:: 134731-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa432-569 from TRIM24 (AAH28689) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains-a RING, a B-box type 1 and a B-box type 2-and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Applications: Suitable for use in FLISA, Immunoprecipitation, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice