TRIM17 (E3 Ubiquitin-protein Ligase TRIM17, RING Finger Protein 16, Testis RING Finger Protein, Tripartite Motif-containing Protein 17, RBCC, RNF16, TERF)

Size

£685.00

SKU:: 134725
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa75-184 of human TRIM17 with GST tag (NP_057186). MW of the GST tag alone is 26kD.
Clone:: 2E11
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: May function as an ubiquitin E3 ligase. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKERRER Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.