TRIB3 (Tribbles Homolog 3, TRB3, TRB-3, Neuronal Cell Death-inducible Putative Kinase, NIPK, p65-interacting Inhibitor of NF-kappa-B, C20orf97, SINK, SKIP3)

Size

£685.00

SKU:: 134719
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa56-145 from human TRIB3 (AAH27484) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.