134700-APC

Trefoil Factor 2 (TFF2, SML1, Spasmolysin, Spasmolytic Polypeptide, SP) (APC)

Size

£927.00

SKU:: 134700-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-130 from human TFF2 (AAH32820) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A10
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Human spasmolytic polypeptide (HSP) is a trefoil peptide found prominently in the foveolar and surface epithelium, pyloric glands and mucous neck cells of the stomach. This antibody will help detect HSP in normal and uncharacterized tissues. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.