TRA2B (SFRS10, Transformer-2 Protein Homolog beta, Splicing Factor, Arginine/Serine-rich 10, TRA-2 beta, TRA2-beta, hTRA2-beta, Transformer-2 Protein Homolog B, DKFZp686F18120)

Size

£685.00

SKU:: 134660
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa120-199 from SFRS10 (NP_004584) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7A1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: TRA2B is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.