134621
TP53BP2 (Tumor Suppressor p53-binding Protein 2, 53BP2, p53-binding Protein 2, p53BP2, Apoptosis-stimulating of p53 Protein 2, ASPP2, Bcl2-binding Protein, Bbp, Renal Carcinoma Antigen NY-REN-51, PPP1R13A)
Size
£685.00
- SKU:
- 134621
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa511-610 from human TP53BP2 (AAH58918) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3F8
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice