134594-FITC
TOB2 (Protein Tob2, Transducer of erbB-2 2, Protein Tob4, KIAA1663, TOB4, TOBL, TROB2) (FITC)
Size
£914.00
- SKU:
- 134594-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-344 from human TOB2 (AAH38957) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F2-1A7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- TOB2 is a 344aa rich novel member of the Tob:BTG1 anti-proliferative family of proteins characterized by similarities in their N-terminal BTG:Tob homology domains. This anti-proliferative protein inhibits cell cycle progression from the G0:G1 to S phases and is involved in cell cycle regulation through interaction with Caf1, a component of the CCR4 transcription factor complex that associates with cyclin-dependent kinases. Recent reports suggest that TOB2 plays important roles in spermatogenesis, embryonic dorsoventral patterning, osteogenesis, T-cell activation, learning and memory and acts primarily as a transcriptional repressor in several signaling pathways. TOB2, a signaling protein, may participate in transcriptional regulation of several genes. It is a regulatory protein ubiquitously expressed in most of the tissues. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLAN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice