TNFRSF12A (Tumor Necrosis Factor Receptor Superfamily Member 12A, CD266, Fibroblast Growth Factor-inducible Immediate-early Response Protein 14, FGF-inducible 14, FN14, Tweak-receptor, TweakR)

Size

£685.00

SKU:: 134538
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa28-129 from human TNFRSF12A with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B6
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.