134538-BIOTIN

TNFRSF12A (Tumor Necrosis Factor Receptor Superfamily Member 12A, CD266, Fibroblast Growth Factor-inducible Immediate-early Response Protein 14, FGF-inducible 14, FN14, Tweak-receptor, TweakR) (Biotin)

Size

£914.00

SKU:: 134538-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa28-129 from human TNFRSF12A with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B6
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.