134500-BIOTIN

TRAPPC10 (Trafficking Protein Particle Complex Subunit 10, Epilepsy Holoprosencephaly Candidate 1 Protein, EHOC1, EHOC-1, Protein GT334, Trafficking Protein Particle Complex Subunit TMEM1, Transport Protein Particle Subunit TMEM1, TRAPP Subunit TMEM1, TMEM1) (Biotin)

Size

£914.00

SKU:: 134500-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1162-1258 from human TMEM1 (NP_003265) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.