134424-ML650
THRSP (Thyroid Hormone-inducible Hepatic Protein, Spot 14 Protein, S14, MGC21659, S14, SPOT14) (MaxLight 650)
Size
£914.00
- SKU:
- 134424-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-85 from human THRSP (NP_003242) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. S14 (Thyroid Hormone Inducible Hepatic Protein) is a nuclear protein communicates the status of dietary fuels and fuel-related hormones to genes required for long-chain fatty acid synthesis. In mammary glands S14 is important for both epithelial proliferation and milk fat production. High expression of S14 in primary invasive breast cancer is predicative of recurrence. S14 also medicates the induction of lipogenesis by protestin in breast cancer cells and accelerates their growth. Applications: Suitable for use in FLISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice