134404-APC
THAP1 (THAP Domain-containing Protein 1, 4833431A01Rik, DYT6, FLJ10477, MGC33014) (APC)
Size
£927.00
- SKU:
- 134404-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-214 from human THAP1 (AAH21721) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2C1-2F2
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- DNA-binding transcription regulator that regulates endothelial cell proliferation and G1/S cell-cycle progression. Specifically binds the 5'-[AT]NTNN[GT]GGCA[AGT]-3' core DNA sequence and acts by modulating expression of pRB-E2F cell-cycle target genes, including RRM1. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. May also have pro-apoptopic activity by potentiating both serum-withdrawal and TNF-induced apoptosis. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice