134376-ML650
TG (Thyroglobulin) (MaxLight 650)
Size
£914.00
- SKU:
- 134376-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2659-2769 from human TG (NP_003226) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1G3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Human Thyroglobulin (Tg) is a 660kD, dimeric protein produced by and used entirely within the thyroid gland. Human Thyroglobulin Tg was referred to as 'colloid'. Human Thyroglobulin (Tg) is used by the thyroid gland to produce the thyroid hormones thyroxine (T4) and triiodothyronine. Patients with Hashimoto's thyroiditis or Graves' disease, frequently develop antibodies against human Thyroglobulin (Tg). Human Thyroglobulin Tg-specific antibodies help in the diagnosis of these diseases, but they also may be present in apparently healthy euthyroid individuals. Human Thyroglobulin (Tg) levels in the blood can be used as a tumor marker for certain kinds of thyroid cancer. Thyroglobulin (Tg) levels in the blood can also be elevated in cases of Graves disease. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice