134373
TFPI (Tissue Factor Pathway Inhibitor, TFI, TFPI 1, TFPI1, Extrinsic Pathway Inhibitor, EPI, Lipoprotein-associated Coagulation Inhibitor, LACI)
Size
£685.00
- SKU:
- 134373
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-252 from human TFPI (AAH15514) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- TFPI is also known as lipoproteinassociated coagulation inhibitor (LACI). TFPI encodes a protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates the formation of factor VIIa-TF complex, which proteolytically activates additional proteases and this leads to the formation of a fibrin clot. The encoded protein is glycosylated and primarily found in the vascular endothelium and plasma. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFCIHASMFFLGLDSISCLC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice