TFDP1 (Transcription Factor Dp-1, DRTF1-polypeptide 1, DRTF1, E2F Dimerization Partner 1, DP1)

Size

£685.00

SKU:: 134366
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa112-221 from human TFDP1 (NP_009042) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DP family contains at least two members, DP-1 and -2. Structurally, DP-1 and -2 are relatively conserved, yet their expression appears to be tissue specific. E2F-1, a functional target for the tumor suppressor protein Rb, heterodimers with DP-1 and forms an active E2F transcriptional complex. The interaction between members of the E2F and the DP families is mediated, in part, by a leucine repeat which is weakly conserved between the two families. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.