134366-HRP
TFDP1 (Transcription Factor Dp-1, DRTF1-polypeptide 1, DRTF1, E2F Dimerization Partner 1, DP1) (HRP)
Size
£914.00
- SKU:
- 134366-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa112-221 from human TFDP1 (NP_009042) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3E4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- DP family contains at least two members, DP-1 and -2. Structurally, DP-1 and -2 are relatively conserved, yet their expression appears to be tissue specific. E2F-1, a functional target for the tumor suppressor protein Rb, heterodimers with DP-1 and forms an active E2F transcriptional complex. The interaction between members of the E2F and the DP families is mediated, in part, by a leucine repeat which is weakly conserved between the two families. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice