134366-BIOTIN
TFDP1 (Transcription Factor Dp-1, DRTF1-polypeptide 1, DRTF1, E2F Dimerization Partner 1, DP1) (Biotin)
Size
£914.00
- SKU:
- 134366-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa112-221 from human TFDP1 (NP_009042) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3E4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- DP family contains at least two members, DP-1 and -2. Structurally, DP-1 and -2 are relatively conserved, yet their expression appears to be tissue specific. E2F-1, a functional target for the tumor suppressor protein Rb, heterodimers with DP-1 and forms an active E2F transcriptional complex. The interaction between members of the E2F and the DP families is mediated, in part, by a leucine repeat which is weakly conserved between the two families. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice