134332-PE

TENM1 (ODZ1, Teneurin-1, Ten-1, Protein Odd Oz/Ten-m Homolog 1, Tenascin-M1, Ten-m1, Teneurin Transmembrane Protein 1, TNM1) (PE)

Size

£914.00

SKU:: 134332-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2616-2725 from human ODZ1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Teneurin-1 may function as a cellular signal transducer. It exists as a disulfide-linked homodimer transmembrane protein. It is expressed in fetal brain. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.