134332-BIOTIN

TENM1 (ODZ1, Teneurin-1, Ten-1, Protein Odd Oz/Ten-m Homolog 1, Tenascin-M1, Ten-m1, Teneurin Transmembrane Protein 1, TNM1) (Biotin)

Size

£914.00

SKU:: 134332-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2616-2725 from human ODZ1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Teneurin-1 may function as a cellular signal transducer. It exists as a disulfide-linked homodimer transmembrane protein. It is expressed in fetal brain. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.