134331-ML550
Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin) (MaxLight 550)
Size
£914.00
- SKU:
- 134331-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa181-290 from human TNC (NP_002151) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Tenascin is a hexameric extracellular matrix protein. Tenascin may have a role in guiding migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. In the embryo, Tenascin is found in developing epithelia, cartilage and bone. In the adult, Tenascin is found in smooth muscle, tendon and hyper-proliferative skin. At least 6 isoforms of human Tenascin are produced by alternative splicing. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~10ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice