TCF3 (Transcription Factor E2-alpha, Class B Basic Helix-loop-helix Protein 21, bHLHb21, Immunoglobulin Enhancer-binding Factor E12/E47, Immunoglobulin Transcription Factor 1, Kappa-E2-binding Factor, Transcription Factor 3, TCF-3, Transcription Factor ITF-1, BHLHB21, E2A, ITF1, MGC129647, MGC129648)

Size

£685.00

SKU:: 134293
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa545-655 from human TCF3 (NP_003191) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5G2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. Binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.