TCF2 (Hepatocyte Nuclear Factor 1-beta, HNF-1-beta, HNF-1B, Homeoprotein LFB3, Transcription Factor 2, TCF-2, Variant Hepatic Nuclear Factor 1, vHNF1, HNF1B)

Size

£685.00

SKU:: 134292
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa29-118 from human TCF2 (NP_000449) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene encodes a member of the transcription factor superfamily. The encoded protein forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.