TCF19 (Transcription Factor 19, TCF-19, SC1, SC1-1, Transcription Factor SC1)

Size

£685.00

SKU:: 134289
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa17-103 from human TCF19 (NP_009040) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6D8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: SC1 is a extracellular matrix glycoprotein playing an important role in neural developmental processes like axon guidance and synaptogenesis. Higher resolution analysis using electron microscopy indicated that SC1 localizes to synapses. SC1 was also detected in perisynaptic glial processes that envelop synapses. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.