134266
TBX3 (T-box 3, T-box Family of Transcription Factors, T-box Protein 3)
Size
£685.00
- SKU:
- 134266
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa311-411 from human TBX3 (NP_005987) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3A7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice