TBX22 (T-box Transcription Factor TBX22, T-box Protein 22, TBOX22)

Size

£685.00

SKU:: 134265
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa431-520 from human TBX22 (NP_058650) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: T-box transcription factors contain a novel type of DNA-binding domain, the T-box domain, which are encoded by an ancient gene family. Four T-box genes, omb, Trg, org-1, and H15, have been identified in Drosophila, whereas in mammals the T-box gene family has expanded, and 12 human T-box genes have been isolated. Most T-box genes have discrete spatial and temporal patterns of expression during embryogenesis. Mutations in T-box 22 (TBX22) have been associated with the inherited X-linked disorder cleft palate with ankyloglossia. There is evidence that TBX22 seems to play a major role in human palatogenesis. In mouse embryos, TBX22 is expressed in distinct areas of the head, namely the mesenchyme of the inferior nasal septum, the posterior palatal shelf before fusion, the attachment of the tongue, and mesenchymal cells surrounding the eye anlage. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice