134260-PE
TBX18 (T-box Transcription Factor TBX18, T-box Protein 18) (PE)
Size
£914.00
- SKU:
- 134260-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa454-560 from TBX18 (XP_496819) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3C12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- TBX18 is a 607aa, 65kD protein that is a member of the T-box family of developmentally expressed transcription factors. It is developmentally expressed in the anterior portion of the head, somites and limb buds. It is expressed on pluripotent progenitors in the developing epicardium where it is required for formation of the cardiac AV node, and can also contribute to fibroblast and smooth muscle formation. Within the region used as an immunogen, human TBX18 shares 93% aa identity with mouse and rat TBX18. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice