134215-APC

TAP1 (Antigen Peptide Transporter 1, APT1, Peptide Transporter TAP1, ATP-Binding Cassette Sub-family B Member 2, Peptide Supply Factor 1, Peptide Transporter PSF1, PSF-1, Peptide Transporter Involved In Antigen Processing 1, Really Interesting New Gene 4 Protein, ABCB2, PSF1, RING4, Y3, FLJ26666, FLJ41500) (APC)

Size

£927.00

SKU:: 134215-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa241-350 from human TAP1 (AAH14081) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B4
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: PSF1 is a member of the GINS complex (PSF1, PSF2, PSF3 and SLD5) and regulates DNA replication in yeast. In mammals, PSF1 is essential for acute proliferation of stem cells in a variety of tissues. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.