134212-ML550
TAOK1 (Serine/Threonine-protein Kinase TAO1, Kinase from Chicken Homolog B, hKFC-B, MARK Kinase, MARKK, Prostate-derived Sterile 20-like Kinase 2, PSK-2, PSK2, Prostate-derived STE20-like Kinase 2, Thousand and One Amino Acid Protein Kinase 1, hTAOK1, KIAA1361, MAP3K16, MARKK, FLJ14314) (MaxLight 550)
Size
£914.00
- SKU:
- 134212-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa892-1002 from human TAOK1 (NP_065842) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4E12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Serine/threonine-protein kinase TAO1 is an enzyme that in humans is encoded by the TAOK1 gene. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice