134211-BIOTIN
TAO Kinase 2 (Thousand and One Amino Acid Protein Kinase 2, TAOK2, TAO2, KIAA0881, Kinase from Chicken Homolog C, hKFC-C, MAP3K17, Prostate-derived Sterile 20-like Kinase 1, Prostate-derived STE20-like Kinase 1, PSK1, PSK-1, PSK, Serine/threonine-protein Kinase TAO2, UNQ2971/PRO7431) (Biotin)
Size
£914.00
- SKU:
- 134211-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa831-930 from TAOK2 (AAH51798) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- TAO kinase 2 (Serine/threonine-protein kinase TAO2) belongs to the MAP kinase family. It activates the JNK MAP kinase pathway through the specific activation of the MAP2Ks MEK3 and MEK6. TAO kinase 2 mediates signaling from carbachol, relaying signals from carbachol through heterotrimeric G proteins to the p38 MAP kinase and ternary complex factors. It alters actin cytoskeletal organization and interacts with microtubules affecting their organization and stability independently of TAO kinase activity. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice