TAGLN3 (Transgelin-3, Neuronal Protein NP25, Neuronal Protein 22, NP22, NP25)

Size

£685.00

SKU:: 134204
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-200 from human TAGLN3 (AAH15329) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: TAGLN3, contains a putative Actin-binding domain, two EF-hand motifs, two potential phosphorylation sites and a calponin-homology (CH) domain. It shares homology with transgelin and calponin, two cytoskeleton-interacting proteins. Belonging to the calponin family, TAGLN3 colocalizes with Actin and tubulin, suggesting a possible role for it in neuronal plasticity or as a signaling protein. Due to a varied expression pattern, it may play different roles in the developing and adult brain. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice