134204-BIOTIN
TAGLN3 (Transgelin-3, Neuronal Protein NP25, Neuronal Protein 22, NP22, NP25) (Biotin)
Size
£914.00
- SKU:
- 134204-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-200 from human TAGLN3 (AAH15329) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- TAGLN3, contains a putative Actin-binding domain, two EF-hand motifs, two potential phosphorylation sites and a calponin-homology (CH) domain. It shares homology with transgelin and calponin, two cytoskeleton-interacting proteins. Belonging to the calponin family, TAGLN3 colocalizes with Actin and tubulin, suggesting a possible role for it in neuronal plasticity or as a signaling protein. Due to a varied expression pattern, it may play different roles in the developing and adult brain. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice