TAF1 (Transcription Initiation Factor TFIID Subunit 1, Cell Cycle Gene 1 Protein, TBP-associated Factor 250kD, p250, Transcription Initiation Factor TFIID 250kD Subunit, TAF(II)250, TAFII-250, TAFII250, BA2R, CCG1, CCGS, TAF2A)

Size

£685.00

SKU:: 134170
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1784-1894 from human TAF1 (NP_004597) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: BTAF1 regulates transcription in association with TATA binding protein (TBP). It removes TBP from the TATA box in an ATP-dependent manner. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.