134170-FITC

TAF1 (Transcription Initiation Factor TFIID Subunit 1, Cell Cycle Gene 1 Protein, TBP-associated Factor 250kD, p250, Transcription Initiation Factor TFIID 250kD Subunit, TAF(II)250, TAFII-250, TAFII250, BA2R, CCG1, CCGS, TAF2A) (FITC)

Size

£914.00

SKU:: 134170-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1784-1894 from human TAF1 (NP_004597) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: BTAF1 regulates transcription in association with TATA binding protein (TBP). It removes TBP from the TATA box in an ATP-dependent manner. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.