134170-APC

TAF1 (Transcription Initiation Factor TFIID Subunit 1, Cell Cycle Gene 1 Protein, TBP-associated Factor 250kD, p250, Transcription Initiation Factor TFIID 250kD Subunit, TAF(II)250, TAFII-250, TAFII250, BA2R, CCG1, CCGS, TAF2A) (APC)

Size

£927.00

SKU:: 134170-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1784-1894 from human TAF1 (NP_004597) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E11
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: BTAF1 regulates transcription in association with TATA binding protein (TBP). It removes TBP from the TATA box in an ATP-dependent manner. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.