Tachykinin Receptor 1 (TAC1R, TACR1, NK-1 Receptor, NK1R, NK-1R, NKIR, Substance-P Receptor, SPR)

Size

£685.00

SKU:: 134166
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa140-244 from human TACR1 (NP_001049) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Tachykinin Receptor 1, a member of the Tachykinin Receptor subfamily, is involved in the mediation of phosphatidylinositol metabolism by the tachykinin substance P, also referred to as neurokinin 1. It is associated with the management of depression, anxiety, and stress. It is also involved in regulating behavioral responses, neuronal survival, and cardiovascular and respiratory functions. The tachykinin receptor 1 is implicated in the progression of rheumatoid arthritis and osteoarthritis. Two variants of the tachykinin receptor 1 are produced by alternative splicing. Tachykinin receptor 1 has been reported primarily in brain, and in blood lymphocytes, nose, small intestine, and stomach. ESTs have been isolated from brain and spleen libraries. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice