134166-APC

Tachykinin Receptor 1 (TAC1R, TACR1, NK-1 Receptor, NK1R, NK-1R, NKIR, Substance-P Receptor, SPR) (APC)

Size

£927.00

SKU:: 134166-APC
Application:: FLISA
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa140-244 from human TACR1 (NP_001049) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F7
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Tachykinin Receptor 1, a member of the Tachykinin Receptor subfamily, is involved in the mediation of phosphatidylinositol metabolism by the tachykinin substance P, also referred to as neurokinin 1. It is associated with the management of depression, anxiety, and stress. It is also involved in regulating behavioral responses, neuronal survival, and cardiovascular and respiratory functions. The tachykinin receptor 1 is implicated in the progression of rheumatoid arthritis and osteoarthritis. Two variants of the tachykinin receptor 1 are produced by alternative splicing. Tachykinin receptor 1 has been reported primarily in brain, and in blood lymphocytes, nose, small intestine, and stomach. ESTs have been isolated from brain and spleen libraries. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice