134157-PE
T (Brachyury Protein, Protein T, MGC104817) (PE)
Size
£914.00
- SKU:
- 134157-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa222-321 from human T (NP_003172) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5H8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- Brachyury is a 435aa containing embryonic nuclear transcription factor binding to the palindromic T-site. It binds to the T-box in the N-terminus to regulate the genes required for mesodermal differentiation. It is the earliest indicator of mesoderm formation and differentiation. Brachyury is expressed during gastrula and neurula stages in involuting mesoderm and in the notochord. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice